>5mr9_B mol:protein length:102  Neurturin
ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRL
RRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV