>5n8a_A mol:protein length:121  Replication protein A 70 kDa DNA-binding subunit
HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFML
ATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVP
YNE