>5n8a_X mol:protein length:102  DNA-directed primase/polymerase protein
MGSSHHHHHHSSGLVPRGSHMTTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGI
DDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE