>5no2_F mol:protein length:106  30S ribosomal protein S6
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY
VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAK