>5no2_N mol:protein length:100  30S ribosomal protein S14
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQ
RNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW