>5no2_Q mol:protein length:80  30S ribosomal protein S17
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIR
ECRPLSKTKSWTLVRVVEKAV