>5no2_R mol:protein length:55  30S ribosomal protein S18
EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRH