>5no6_I mol:protein length:73  Transcriptional enhancer factor TEF-3
EGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQV
SSHIQVLARRKARE