>5o6i_K mol:protein length:200  Homing endonuclease I-DmoI
MAHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHFAPLMQF
LIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFTNMLERIRLCNMREQIAFIKGLYVAE
GDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLNISLRDRIKFVHT
ILSSHLNPLPPEAAALEHHHHHH