>5okz_T mol:protein length:190  M-phase phosphoprotein 6 homolog
GPDSMSANNGVTGKLSSRVMNMKFMKFGKTDDEESSNSNTPSNINSDVEPIEQKGKLFG
LDDSAWDLNSYKDDLKKISGKEKKKVKRVVYKKRPNLIISNVGYSELRKPEGVISGRKT
FGDNSDDSGSRKRKFDEGEQNEDEKRDAKDKEFTGSQDDGEDEYDLDKLFKDSIKKKKT
NHNGKNKNRNSKK