>5okz_Z mol:protein length:250  Exosome complex component MTR3
MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHTGFIENCNGS
ALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLM
GIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMTSSQISSLIPHCITSIT
LALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNR
YRDLMISCLMNQET