>5ond_B mol:protein length:162  Transcription antitermination protein RfaH
MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEF
DPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYKPKDIVDPATPYPGDKVII
TEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKNTEFRKA