>5ong_A mol:protein length:135  Histone H3.2
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHCYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVT
IMPKDIQLARRIRGERA