>5oqn_A mol:protein length:871  Condensin complex subunit 3
MGIDINTKIFNSVAEVFQKAQGSYAGHRKHIAVLKKIQSKAVEQGYEDAFNFWFDKLVT
KILPLKKNEIIGDRIVKLVAAFIASLERELILAKKQNYKLTNDEEGIFSRFVDQFIRHV
LRGVESPDKNVRFRVLQLLAVIMDNIGEIDESLFNLLILSLNKRIYDREPTVRIQAVFC
LTKFQDEEQTEHLTELSDNEENFEATRTLVASIQNDPSAEVRRAAMLNLINDNNTRPYI
LERARDVNIVNRRLVYSRILKSMGRKCFDDIEPHIFDQLIEWGLEDRELSVRNACKRLI
AHDWLNALDGDLIELLEKLDVSRSSVCVKAIEALFQSRPDILSKIKFPESIWKDFTVEI
AFLFRAIYLYCLDNNITEMLEENFPEASKLSEHLNHYILLRYHHNDISNDSQSHFDYNT
LEFIIEQLSIAAERYDYSDEVGRRSMLTVVRNMLALTTLSEPLIKIGIRVMKSLSINEK
DFVTMAIEIINDIRDDDIEKQESESDIINNLPPEKEASSATIVLCLTRSSYMLELVNTP
LTENILIASLMDTLITPAVRNTAPNIRELGVKNLGLCCLLDVKLAIDNMYILGMCVSKG
NASLKYIALQVIVDIFSVHGNTVVDGEGKVDSISLHKIFYKVLKNNGLPECQVIAAEGL
CKLFLADVFTDDDLFETLVLSYFSPINSSNEALVQAFAFCIPVYCFSHPAHQQRMSRTA
ADILLRLCVLWDDLQSSVIPEVDREAMLKPNIIFQQLLFWTDPRNLVNQTGSTKKDTVQ
LTFLIDVLKIYAQIEKKEIKKMIITNINAIFLSSEQDYSTLKELLEYSDDIAENDNLDN
VSKNALDKLRNNLNSLIEEINERSETQTKDENNTANDQYSSILGN