>5oy0_0 mol:protein length:154  Photosystem I reaction center subunit XI
SNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLI
GPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWS
QFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN