>5oy0_D mol:protein length:141  Photosystem I reaction center subunit II
MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYL
ARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTK
TRRIGQNPEPVTIKFSGKAPYEV