>5oy0_F mol:protein length:143  Photosystem I reaction center subunit III
ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRF
THAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLW
PLAAVGEYTSGKLVMKDSEIPTSPR