>5oy0_I mol:protein length:40  Photosystem I reaction center subunit VIII
MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG