>5oy0_J mol:protein length:40  Photosystem I reaction center subunit IX
MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP