>5oy0_c mol:protein length:81  Photosystem I iron-sulfur center
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACP
TDFLSIRVYLGAETTRSMGLAY