>5t0g_e mol:protein length:70  26S proteasome complex subunit DSS1
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAE
LEKHGYKMETS