>5to5_B mol:protein length:141  Nucleoprotein TPR
AAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYMEIEKR
LSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQMTRTKEE
LEAEKRDLIRTNERLSQELEYLT