>5tz2_H mol:protein length:229  C47B222 Fab Heavy Chain
EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYWIGWVRQMPGKGLEWMGIIYPGDSDTR
YSPSFQGQVTISADKSISTAYLQWSSLKASDTAVYYCARVGRFASHQLDYWGQGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH