>5u07_A mol:protein length:232  CRISPR-associated protein, Cse3 family
MTWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETR
NELYLLVQSHSPLRVDRLGPGYHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSE
NNTQRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLELLSTYAQTLDDVRDPGTA
DRSRKIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLALIEEGEHG