>5u07_I mol:protein length:373  CRISPR-associated protein, Cse4 family
MTFVDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKA
VRTRRIISEIAKRLRERGWDADLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFY
LPVPAIDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVLKSRNVSVNLFGRMLAEL
PSTEVDGAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYAN
VNLDRLVENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPIS
FAPAFETALYGSDGYTLRACQELNNYAERLREVWPDDAIRGYATVENKTDLAALGERYD
SYPALIDAMVAAAFEGERE