>5u0a_J mol:protein length:244  Cse2
MNSDYILQHADALVKRVSKLIVNEPAARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPT
DYDVDRRRAASLWDVHAVERAFYAVAAIMAAQPRSARDQEAEATEEQTGEPQDSEALTE
PTPAEESSATKDGKPDRRPNLGVSLAQAVFDKGLNADSTEQRLHLIARQNLDGVHRHLP
RLVLYLRSDQVHIDWGILIRDLARWGHTPRHVAREWVQDYHRTLETLTRQAEQKNKNNT
TDEEAEAA