>5u0a_N mol:protein length:254  CRISPR-associated protein, Cas5e family
MSGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKF
TVRVDRPGVRLVDFHTIGGGLPKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVT
GPEADTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVRELVEAVPLPHRRVEEDA
ATVLVDLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIRVVPTEVPATLVAGPGR
DYQNKLFTYVKQCAEEAA