>5uwc_G mol:protein length:288  Interleukin-3 receptor subunit alpha
KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEV
TNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYD
LYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCT
DKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVR
DRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGVNTRAWRTS