>5uws_B mol:protein length:143  Ran-specific GTPase-activating protein 1
GGSDIHFEPVVHLEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNK
KTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAI
RFGSKENADKFKEEFEKAQEINKKA