>5w4a_D mol:protein length:216  P-granule scaffold
MDTNKREIVEFLGIRTYFFPNLALYAVNNDELLVSDPNKANSFAAYVFGASDKKPSVDD
IVQILFPSGSDSGTILTSMDTLLALGPDFLTEFKKRNQDLARFNLTHDLSILAQGDEDA
AKKKLNLMGRKAKLQKTEAAKILAILIKTINSEENYEKFTELSELCGLDLDFDAYVFTK
ILGLEDEDTADEVEVIRDNFLNRLDQTKPKLADIIRNGP