>5w97_F mol:protein length:98  Cytochrome c oxidase subunit 5B, mitochondrial
ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVG
CICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH