>5w97_d mol:protein length:147  Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVEL
YRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAK
QTKRMLDMKVAPIQGFSAKWDYDKNEWKK