>5w97_e mol:protein length:109  Cytochrome c oxidase subunit 5A, mitochondrial
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLN
DFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV