>5w97_l mol:protein length:47  Cytochrome c oxidase subunit 7C, mitochondrial
SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK