>5w97_m mol:protein length:46  Cytochrome c oxidase subunit 8B, mitochondrial
ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA