>5wc9_E mol:protein length:152  Pituitary-specific positive transcription factor 1
GHMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF
KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKP
SSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK