>5wrv_B mol:protein length:163  Signal recognition particle subunit SRP72
MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNG
SFKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQV
LYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEK