>5wwz_A mol:protein length:86  RNA-binding E3 ubiquitin-protein ligase MEX3C
MGHHHHHHMSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEP
VFEVTGMPENVDRAREEIEMHIAMRTG