>5x0x_A mol:protein length:136  Histone H3.2
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKST
ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV
TIMPKDIQLARRIRGERA