>5x11_B mol:protein length:188  Transcriptional regulator
GSAKDPMRVLKYAILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDEGF
ITFRTTIQGTKLEKKMYTLTDSGKQELHDWLIRHQPIPETVKDEFMLKAYFISSLSRQE
ASDLFTDQLLKRKAKLSDLQGSYEKLMASAEPMSFSSPDFGHYLVLTKALEREKNYVSW
LESILAMIDED