>5xf4_A mol:protein length:136  Histone H3.1
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKST
ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRV
TIMPKDIQLARRIRGERA