>5xs0_D mol:protein length:215  DNA repair protein RAD52 homolog
GSHMSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRM
AGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQL
KDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRS
LNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM