>5y7g_C mol:protein length:580  Fanconi-associated nuclease 1 homolog
MGSSHHHHHHSSGLVPRGSHMMHEQYQAPLPVNSPALPEPFYYLHNFRAVLAWIGERYA
DLLDDQERAFIAAFAELPEASQALLVRMVMRKGTLFREGKLAYAEIGDTRAAVQPLLAL
GWVDAQPTLELAQLFGLLKKDELSQLFRDHLGRANLRKDALLERLQPLFPEARRLAEWQ
ADFAEPVYELRCMALCDRLRLMYFGNLWQDWSEFVLADLGIYRYESVEFSADSRGFRLR
ADVDAYLHLFDCRQRFDLGEPLEELLAGLPGEPYANPWLEGRRVKLLFQFAQHCEKQRD
FDLAQRLYRQSSHPGARLRAIRSLERGERFAEAHALAREASCAPESDAERQGLARLLPR
LQGKLGLPRQARAAAPEIDRLDLCLAFPSEPCSVEWAVREHLEEPGCAVHYVENGLINS
LFGLLCWEAIFAAIPGAFFHPFHSAPADLHSADFRQRRAALFEACLGRLEDGSYRDAIR
CRYRDKFGLQSPFVYWELLGEELLEQALDCLPAAHLRAWFERLLEDIPGNRAGLPDLIQ
FWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCYVRWHVDD