>5y9f_V mol:protein length:223  heavy chain of Fab fragment of antibody 28F10
DVKLVESGGGLVKPGGSLKLSCAASGFPFSDYTMSWIRQTPEKRLEWVASISSGGTYTY
YPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMFYCTRASPYYDYDEGYMDYWGQGTS
VTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFP
ALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIVPA