>5yl4_E mol:protein length:143  Stathmin-4
MADMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERR
KYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAML
ERLQEKDKHAEEVRKNKELKEEASR