>5ywb_G mol:protein length:390  ATP-sensitive inward rectifier potassium channel 11
MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDV
FTTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFS
SAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRR
AETLIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQV
DIPMENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTG
ITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRS
LLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS