>5z66_A mol:protein length:563  Periplasmic trehalase
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFDDNPATQTTSPDILLGPLFNDVQ
SAKLFPDQKTFADAVPKSDPLMILADYRMQHTQSSFDLRHFVEMNFTLPAEGEKYVPPA
GQSLREHIDDLWPVLTRTTDKASNKWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLA
ESDHWDKISDMVDNFAYEIDTFGHIPNGNRSYYLSRSQPPFFSMMVELLATHDSDALKK
YRPQMEKEYAYWMDGVDALQPGQANKRVVKLDDGAILNRYWDDRDTPRPESWLDDVNTA
KSNPNRPATEIYRDLRSAAASGWDFSSRWMDDPQKLGTIRTTSIVPVDLNALMFKMEKL
LARASQESGDAASASKYEALATARQKAIESHLWNDKEGWYADYDLKSKKVRNQLTAAAL
FPLYVKAAAQDRADKVAAATSSRLLKPGGIATTTVNSGQQWDAPNGWAPLQWVAAEGLQ
NYGQEKVSMDVTWRFLKNVQHTYDREKKLVEKYDVSTTGTGGGGGEYPLQDGFGWSNGV
TLKMLDRVCPKAKPCDSVPENQPAANDEVAPV