>5zbx_A mol:protein length:141  Histone H3.1,Histone H3-like centromeric protein A,Histone H3.1
GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ
KSTELLIRKLPFQRLVREICQDFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTL
HAKRVTIMPKDIQLARRIRGERA