>5zcj_B mol:protein length:210  Tudor-interacting repair regulator protein
GPGSVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLL
GFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTL
EQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALK
VLNMMPEEKLVEALAAATEKQKKALEKLLPASS