>5zju_b mol:protein length:209  Capsid protein
MGSSHHHHHHSSGLVPRGSHFNTRLSRTFGYTIKRTTVKTPSWAVDMMRFNINDFLPPG
GGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDPYV
NYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTA
FENSIYDQEYNIRVTMYVQFREFNLKDPPLNP